Lineage for d1mfrn_ (1mfr N:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1084172Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1084173Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1084174Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1084175Protein (Apo)ferritin [47246] (8 species)
  7. 1084176Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (7 PDB entries)
  8. 1084196Domain d1mfrn_: 1mfr N: [16705]
    complexed with mg

Details for d1mfrn_

PDB Entry: 1mfr (more details), 2.8 Å

PDB Description: crystal structure of m ferritin
PDB Compounds: (N:) m ferritin

SCOPe Domain Sequences for d1mfrn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfrn_ a.25.1.1 (N:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsv

SCOPe Domain Coordinates for d1mfrn_:

Click to download the PDB-style file with coordinates for d1mfrn_.
(The format of our PDB-style files is described here.)

Timeline for d1mfrn_: