Lineage for d2p6ya1 (2p6y A:1-130)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009890Fold d.290: AF0104/ALDC/Ptd012-like [117855] (1 superfamily)
    duplication: consists of two similar beta-alpha-beta(4) motifs
  4. 3009891Superfamily d.290.1: AF0104/ALDC/Ptd012-like [117856] (4 families) (S)
    characteristic metal ion (zinc)-binding motif in the putative active site
  5. 3009917Family d.290.1.0: automated matches [191426] (1 protein)
    not a true family
  6. 3009918Protein automated matches [190613] (9 species)
    not a true protein
  7. 3009948Species Vibrio cholerae [TaxId:666] [188821] (1 PDB entry)
  8. 3009949Domain d2p6ya1: 2p6y A:1-130 [167039]
    Other proteins in same PDB: d2p6ya2
    automated match to d2hx0a1
    complexed with zn

Details for d2p6ya1

PDB Entry: 2p6y (more details), 1.63 Å

PDB Description: X-ray structure of the protein Q9KM02_VIBCH from Vibrio cholerae at the resolution 1.63 A. Northeast Structural Genomics Consortium target VcR80.
PDB Compounds: (A:) Hypothetical protein VCA0587

SCOPe Domain Sequences for d2p6ya1:

Sequence, based on SEQRES records: (download)

>d2p6ya1 d.290.1.0 (A:1-130) automated matches {Vibrio cholerae [TaxId: 666]}
mihlialrltrgmdlkqqivqlvqqhrihagsiascvgclstlhirladsvstlqvsapf
eilslsgtltyqhchlhiavadaqgrvwgghllegnlinttaelmihhypqhhftrefdp
ntgyselvvs

Sequence, based on observed residues (ATOM records): (download)

>d2p6ya1 d.290.1.0 (A:1-130) automated matches {Vibrio cholerae [TaxId: 666]}
mihlialrltrgmdlkqqivqlvqqhrihagsiascvgclstlhirladsvstlqvsapf
eilslsgtltyqhchlhiavadaqgrvwgghllegnlintaelmihhypqhhftrefdpn
tgyselvvs

SCOPe Domain Coordinates for d2p6ya1:

Click to download the PDB-style file with coordinates for d2p6ya1.
(The format of our PDB-style files is described here.)

Timeline for d2p6ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2p6ya2