Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.290: AF0104/ALDC/Ptd012-like [117855] (1 superfamily) duplication: consists of two similar beta-alpha-beta(4) motifs |
Superfamily d.290.1: AF0104/ALDC/Ptd012-like [117856] (4 families) characteristic metal ion (zinc)-binding motif in the putative active site |
Family d.290.1.0: automated matches [191426] (1 protein) not a true family |
Protein automated matches [190613] (9 species) not a true protein |
Species Vibrio cholerae [TaxId:666] [188821] (1 PDB entry) |
Domain d2p6ya1: 2p6y A:1-130 [167039] Other proteins in same PDB: d2p6ya2 automated match to d2hx0a1 complexed with zn |
PDB Entry: 2p6y (more details), 1.63 Å
SCOPe Domain Sequences for d2p6ya1:
Sequence, based on SEQRES records: (download)
>d2p6ya1 d.290.1.0 (A:1-130) automated matches {Vibrio cholerae [TaxId: 666]} mihlialrltrgmdlkqqivqlvqqhrihagsiascvgclstlhirladsvstlqvsapf eilslsgtltyqhchlhiavadaqgrvwgghllegnlinttaelmihhypqhhftrefdp ntgyselvvs
>d2p6ya1 d.290.1.0 (A:1-130) automated matches {Vibrio cholerae [TaxId: 666]} mihlialrltrgmdlkqqivqlvqqhrihagsiascvgclstlhirladsvstlqvsapf eilslsgtltyqhchlhiavadaqgrvwgghllegnlintaelmihhypqhhftrefdpn tgyselvvs
Timeline for d2p6ya1: