SCOPe 2.03: Domain d2p68a_: 2p68 A:

Lineage for d2p68a_ (2p68 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:224324] [187981] (3 PDB entries)

8. Domain d2p68a_: 2p68 A: [167023]
   automated match to d2c07a1

Details for d2p68a_

PDB Entry: 2p68, 1.84 Å

PDB Description: crystal structure of aq_1716 from aquifex aeolicus vf5

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] reductase

SCOPe Domain Sequences for d2p68a_:

Sequence; same for both SEQRES and ATOM records:

>d2p68a_ c.2.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]}
meiklqgkvslvtgstrgigraiaeklasagstviitgtsgerakavaeeiankygvkah
gvemnllseesinkafeeiynlvdgidilvnnagitrdklflrmslldweevlkvnltgt
flvtqnslrkmikqrwgrivnissvvgftgnvgqvnysttkagligftkslakelaprnv
lvnavapgfietdmtavlseeikqkykeqiplgrfgspeevanvvlflcselasyitgev
ihvnggmf

Timeline for d2p68a_:

• d2p68a_ first appeared in SCOPe 2.01
  
• d2p68a_ appears in SCOPe 2.02
  
• d2p68a_ appears in SCOPe 2.04
  
• d2p68a_ appears in the current release, SCOPe 2.08