Lineage for d1mfrg_ (1mfr G:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46712Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 46713Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 46714Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 46715Protein (Apo)ferritin [47246] (4 species)
  7. 46716Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (7 PDB entries)
  8. 46729Domain d1mfrg_: 1mfr G: [16698]

Details for d1mfrg_

PDB Entry: 1mfr (more details), 2.8 Å

PDB Description: crystal structure of m ferritin

SCOP Domain Sequences for d1mfrg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfrg_ a.25.1.1 (G:) (Apo)ferritin {Bullfrog (Rana catesbeiana)}
vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsv

SCOP Domain Coordinates for d1mfrg_:

Click to download the PDB-style file with coordinates for d1mfrg_.
(The format of our PDB-style files is described here.)

Timeline for d1mfrg_: