Lineage for d2p2qb_ (2p2q B:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573817Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 2573818Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 2573819Family e.23.1.1: Acetyl-CoA synthetase-like [56802] (7 proteins)
  6. 2573832Protein Acetyl-CoA synthetase [90093] (3 species)
  7. 2573844Species Salmonella typhimurium [TaxId:90371] [187974] (6 PDB entries)
  8. 2573854Domain d2p2qb_: 2p2q B: [166972]
    automated match to d1pg3a_
    complexed with prx; mutant

Details for d2p2qb_

PDB Entry: 2p2q (more details), 2.42 Å

PDB Description: acetyl-coa synthetase, r584e mutation
PDB Compounds: (B:) Acetyl-coenzyme A synthetase

SCOPe Domain Sequences for d2p2qb_:

Sequence, based on SEQRES records: (download)

>d2p2qb_ e.23.1.1 (B:) Acetyl-CoA synthetase {Salmonella typhimurium [TaxId: 90371]}
hkhaipaniadrclinpeqyetkykqsindpdtfwgeqgkildwitpyqkvkntsfapgn
vsikwyedgtlnlaancldrhlqengdrtaiiwegddtsqskhisyrelhrdvcrfantl
ldlgikkgdvvaiympmvpeaavamlacarigavhsvifggfspeavagriidsssrlvi
tadegvragrsiplkknvddalknpnvtsvehvivlkrtgsdidwqegrdlwwrdlieka
spehqpeamnaedplfilytsgstgkpkgvlhttggylvyaattfkyvfdyhpgdiywct
advgwvtghsyllygplacgattlmfegvpnwptparmcqvvdkhqvnilytaptairal
maegdkaiegtdrsslrilgsvgepinpeawewywkkigkekcpvvdtwwqtetggfmit
plpgaielkagsatrpffgvqpalvdneghpqegategnlvitdswpgqartlfgdherf
eqtyfstfknmyfsgdgarrdedgyywitgrvddvlnvsghrlgtaeiesalvahpkiae
aavvgiphaikgqaiyayvtlnhgeepspelyaevrnwvekeigplatpdvlhwtdslpk
trsgkimrrilrkiaagdtsnlgdtstladpgvveklleekqai

Sequence, based on observed residues (ATOM records): (download)

>d2p2qb_ e.23.1.1 (B:) Acetyl-CoA synthetase {Salmonella typhimurium [TaxId: 90371]}
hkhaipaniadrclinpeqyetkykqsindpdtfwgeqgkildwitpyqkvkntsfapgn
vsikwyedgtlnlaancldrhlqengdrtaiiwegddtsqskhisyrelhrdvcrfantl
ldlgikkgdvvaiympmvpeaavamlacarigavhsvifggfspeavagriidsssrlvi
tadegvragrsiplkknvddalknpnvtsvehvivlkrtgsdidwqegrdlwwrdlieka
spehqpeamnaedplfilytsgstgkpkgvlhttggylvyaattfkyvfdyhpgdiywct
advgwvtghsyllygplacgattlmfegvpnwptparmcqvvdkhqvnilytaptairal
maegdkaiegtdrsslrilgsvgepinpeawewywkkigkekcpvvdtwwqtetggfmit
plpgaielkagsatrpffgvqpalvdneghpqegategnlvitdswpgqartlfgdherf
eqtyfstfknmyfsgdgarrdedgyywitgrvddvlnvsghrlgtaeiesalvahpkiae
aavvgiphaikgqaiyayvtlnhgeepspelyaevrnwvekeigplatpdvlhwtdslpk
trsgkimrrilrkiaagdtladpgvveklleekqai

SCOPe Domain Coordinates for d2p2qb_:

Click to download the PDB-style file with coordinates for d2p2qb_.
(The format of our PDB-style files is described here.)

Timeline for d2p2qb_: