Lineage for d1mfrb_ (1mfr B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766020Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 766021Protein (Apo)ferritin [47246] (7 species)
  7. 766022Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (7 PDB entries)
  8. 766030Domain d1mfrb_: 1mfr B: [16693]

Details for d1mfrb_

PDB Entry: 1mfr (more details), 2.8 Å

PDB Description: crystal structure of m ferritin
PDB Compounds: (B:) m ferritin

SCOP Domain Sequences for d1mfrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfrb_ a.25.1.1 (B:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsv

SCOP Domain Coordinates for d1mfrb_:

Click to download the PDB-style file with coordinates for d1mfrb_.
(The format of our PDB-style files is described here.)

Timeline for d1mfrb_: