SCOPe 2.03: Domain d2oxtd_: 2oxt D:

Lineage for d2oxtd_ (2oxt D:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (42 species)
   not a true protein

7. Species Meaban virus [TaxId:35279] [188819] (1 PDB entry)

8. Domain d2oxtd_: 2oxt D: [166917]
   automated match to d1l9ka_
   complexed with sam

Details for d2oxtd_

PDB Entry: 2oxt, 2.9 Å

PDB Description: Crystal structure of Meaban virus nucleoside-2'-O-methyltransferase

PDB Compounds: (D:) nucleoside-2'-o-methyltransferase

SCOPe Domain Sequences for d2oxtd_:

Sequence; same for both SEQRES and ATOM records:

>d2oxtd_ c.66.1.0 (D:) automated matches {Meaban virus [TaxId: 35279]}
gpgstgaslgmmwkdklnamtkeeftrykragvmetdrkeardylkrgdgktglsvsrgt
aklawmeergyveltgrvvdlgcgrggwsyyaasrphvmdvraytlgvgghevpritesy
gwnivkfksrvdihtlpvertdvimcdvgesspkwsvesertikilellekwkvknpsad
fvvkvlcpysvevmerlsvmqrkwggglvrnpysrnsthemyftsraggniigavtacte
rllgrmarrdgpvvvpelnlgtgtr

Timeline for d2oxtd_:

• d2oxtd_ first appeared in SCOPe 2.01
  
• d2oxtd_ appears in SCOPe 2.02
  
• d2oxtd_ appears in SCOPe 2.04
  
• d2oxtd_ appears in the current release, SCOPe 2.08