![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
![]() | Protein automated matches [190689] (87 species) not a true protein |
![]() | Species Meaban virus [TaxId:35279] [188819] (1 PDB entry) |
![]() | Domain d2oxtc_: 2oxt C: [166916] automated match to d1l9ka_ complexed with sam |
PDB Entry: 2oxt (more details), 2.9 Å
SCOPe Domain Sequences for d2oxtc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oxtc_ c.66.1.0 (C:) automated matches {Meaban virus [TaxId: 35279]} gpgstgaslgmmwkdklnamtkeeftrykragvmetdrkeardylkrgdgktglsvsrgt aklawmeergyveltgrvvdlgcgrggwsyyaasrphvmdvraytlgvgghevpritesy gwnivkfksrvdihtlpvertdvimcdvgesspkwsvesertikilellekwkvknpsad fvvkvlcpysvevmerlsvmqrkwggglvrnpysrnsthemyftsraggniigavtacte rllgrmarrdgpvvvpelnlgtgtr
Timeline for d2oxtc_: