Lineage for d1rcca_ (1rcc A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1484439Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1484440Protein (Apo)ferritin [47246] (8 species)
  7. 1484441Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (17 PDB entries)
  8. 1484456Domain d1rcca_: 1rcc A: [16690]
    complexed with bet

Details for d1rcca_

PDB Entry: 1rcc (more details), 2.4 Å

PDB Description: bullfrog red cell l ferritin tartrate/mg/ph 5.5
PDB Compounds: (A:) l ferritin

SCOPe Domain Sequences for d1rcca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcca_ a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
sqvrqnfhqdceaglnrtvnlkfhssyvylsmasyfnrddvalsnfakffrersaaakah
aeklieyqnqrggrvflqsvekperddwanglealqtalklqksvnqalldlhavaadks
dphmtdflespylsesvetikklgdhitslkklwsshpgmaeylfnkhtlg

SCOPe Domain Coordinates for d1rcca_:

Click to download the PDB-style file with coordinates for d1rcca_.
(The format of our PDB-style files is described here.)

Timeline for d1rcca_: