Lineage for d1rcc__ (1rcc -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.25: Ferritin-like [47239] (1 superfamily) Superfamily a.25.1: Ferritin-like [47240] (2 families) 
Family a.25.1.1: Ferritin [47241] (4 proteins) 
Protein (Apo)ferritin [47246] (3 species) 
Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (7 PDB entries) 
Domain d1rcc__: 1rcc - [16690]
Details for d1rcc__
PDB Entry: 1rcc (more details), 2.4 Å
PDB Description: bullfrog red cell l ferritin tartrate/mg/ph 5.5
SCOP Domain Sequences for d1rcc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rcc__ a.25.1.1 (-) (Apo)ferritin {Bullfrog (Rana catesbeiana)}
sqvrqnfhqdceaglnrtvnlkfhssyvylsmasyfnrddvalsnfakffrersaaakah
aeklieyqnqrggrvflqsvekperddwanglealqtalklqksvnqalldlhavaadks
dphmtdflespylsesvetikklgdhitslkklwsshpgmaeylfnkhtlg
SCOP Domain Coordinates for d1rcc__:
Click to download the PDB-style file with coordinates for d1rcc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rcc__:
- d1rcc__ appears in SCOP 1.57
- d1rcc__ appears in the current release, SCOPe 2.08, called d1rcca_
View in 3D