SCOPe 2.06: Domain d2ox9a_: 2ox9 A:

Lineage for d2ox9a_ (2ox9 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (16 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187331] (21 PDB entries)

8. Domain d2ox9a_: 2ox9 A: [166896]
   automated match to d1t8ca1
   complexed with ca

Details for d2ox9a_

PDB Entry: 2ox9, 1.95 Å

PDB Description: mouse scavenger receptor c-type lectin carbohydrate-recognition domain.

PDB Compounds: (A:) Collectin placenta 1

SCOPe Domain Sequences for d2ox9a_:

Sequence; same for both SEQRES and ATOM records:

>d2ox9a_ d.169.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gcpphwknftdkcyyfslekeifedaklfcedksshlvfinsreeqqwikkhtvgreshw
igltdseqesewkwldgspvdyknwkagqpdnwgsghgpgedcagliyagqwndfqcdei
nnficekere

Timeline for d2ox9a_:

• d2ox9a_ first appeared in SCOPe 2.01
  
• d2ox9a_ appears in SCOPe 2.05
  
• d2ox9a_ appears in SCOPe 2.07
  
• d2ox9a_ appears in the current release, SCOPe 2.08