SCOPe 2.06: Domain d2ox8b_: 2ox8 B:

Lineage for d2ox8b_ (2ox8 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (78 PDB entries)

8. Domain d2ox8b_: 2ox8 B: [166893]
   automated match to d1dv8a_
   complexed with ca, cl, zn

Details for d2ox8b_

PDB Entry: 2ox8, 2.5 Å

PDB Description: Human Scavenger Receptor C-type Lectin carbohydrate-recognition domain.

PDB Compounds: (B:) Scavenger receptor with C-type lectin type I

SCOPe Domain Sequences for d2ox8b_:

Sequence; same for both SEQRES and ATOM records:

>d2ox8b_ d.169.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
scpphwknftdkcyyfsvekeifedaklfcedksshlvfintreeqqwikkqmvgreshw
igltdserenewkwldgtspdyknwkagqpdnwghghgpgedcagliyagqwndfqcedv
nnficekdr

Timeline for d2ox8b_:

• d2ox8b_ first appeared in SCOPe 2.01
  
• d2ox8b_ appears in SCOPe 2.05
  
• d2ox8b_ appears in SCOPe 2.07
  
• d2ox8b_ appears in the current release, SCOPe 2.08