Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein (Apo)ferritin [47246] (8 species) |
Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (22 PDB entries) |
Domain d1rcga_: 1rcg A: [16689] complexed with bet |
PDB Entry: 1rcg (more details), 2.2 Å
SCOPe Domain Sequences for d1rcga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rcga_ a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]} sqvrqnfhqdceaglnrtvnlkfhssyvylsmasyfnrddvalsnfakffrerseeekeh aeklieyqnqrggrvflqsvekperddwanglealqtalklqksvnqalldlhavaadks dphmtdflespylsesvetikklgdhitslkklwsshpgmaeylfnkhtlg
Timeline for d1rcga_: