Lineage for d2ox5c_ (2ox5 C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1771068Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1771069Protein automated matches [190226] (43 species)
    not a true protein
  7. 1771261Species Paracoccus denitrificans [TaxId:266] [187968] (3 PDB entries)
  8. 1771267Domain d2ox5c_: 2ox5 C: [166889]
    automated match to d1v8ha1
    complexed with act, edo, so4

Details for d2ox5c_

PDB Entry: 2ox5 (more details), 1.98 Å

PDB Description: The SoxYZ complex of Paracoccus pantotrophus
PDB Compounds: (C:) SoxZ protein

SCOPe Domain Sequences for d2ox5c_:

Sequence, based on SEQRES records: (download)

>d2ox5c_ b.1.18.0 (C:) automated matches {Paracoccus denitrificans [TaxId: 266]}
addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv
vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiava

Sequence, based on observed residues (ATOM records): (download)

>d2ox5c_ b.1.18.0 (C:) automated matches {Paracoccus denitrificans [TaxId: 266]}
addakprvkvpssakagetvtvkalishkmesgqrkliprsiinrftcelngvnvvdvai
dpavstnpyfefdakvdaagefkftwydddgsvyedvkpiava

SCOPe Domain Coordinates for d2ox5c_:

Click to download the PDB-style file with coordinates for d2ox5c_.
(The format of our PDB-style files is described here.)

Timeline for d2ox5c_: