Lineage for d1rcia_ (1rci A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 638520Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 638521Protein (Apo)ferritin [47246] (7 species)
  7. 638522Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (7 PDB entries)
  8. 638525Domain d1rcia_: 1rci A: [16688]
    complexed with bet; mutant

Details for d1rcia_

PDB Entry: 1rci (more details), 2 Å

PDB Description: bullfrog red cell l ferritin tartrate/mg/ph 5.5
PDB Compounds: (A:) l ferritin

SCOP Domain Sequences for d1rcia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcia_ a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
sqvrqnfhqdceaglnrtvnlkfyssyvylsmasyfnrddvalsnfakffrerseeekeh
aeklieyqnqrggrvflqsvekperddwanglealqtalklqksvnqalldlhavaadks
dphmtdflespylsesvetikklgdhitslkklwsshpgmaeylfnkhtlg

SCOP Domain Coordinates for d1rcia_:

Click to download the PDB-style file with coordinates for d1rcia_.
(The format of our PDB-style files is described here.)

Timeline for d1rcia_: