SCOPe 2.01: Domain d2owca_: 2owc A:

Lineage for d2owca_ (2owc A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein automated matches [190099] (3 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [188525] (3 PDB entries)

8. Domain d2owca_: 2owc A: [166873]
   automated match to d1cwya_
   complexed with acr, gol, mli

Details for d2owca_

PDB Entry: 2owc, 2.05 Å

PDB Description: structure of a covalent intermediate in thermus thermophilus amylomaltase

PDB Compounds: (A:) 4-alpha-glucanotransferase

SCOPe Domain Sequences for d2owca_:

Sequence; same for both SEQRES and ATOM records:

>d2owca_ c.1.8.1 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
melprafglllhptslpgpygvgvlgqeardflrflkeaggrywqvlplgptgygdspyq
sfsafagnpylidlrplaergyvrledpgfpqgrvdygllyawkwpalkeafrgfkekas
peereafaafrereawwledyalfmalkgahgglpwnrwplplrkreekalreaksalae
evafhaftqwlffrqwgalkaeaealgiriigdmpifvaedsaevwahpewfhldeegrp
tvvagvppdyfsetgqrwgnplyrwdvleregfsfwirrlekalelfhlvridhfrgfea
yweipascptavegrwvkapgeklfqkiqevfgevpvlaedlgvitpevealrdrfglpg
mkvlqfafddgmenpflphnypahgrvvvytgthdndttlgwyrtatphekafmarylad
wgitfreeeevpwalmhlgmksvarlavypvqdvlalgsearmnypgrpsgnwawrllpg
elspehgarlramaeaterl

Timeline for d2owca_:

• d2owca_ is new in SCOPe 2.01-stable
  
• d2owca_ appears in SCOPe 2.02
  
• d2owca_ appears in the current release, SCOPe 2.08