SCOP 1.75: Domain d1rcda_: 1rcd A:

Lineage for d1rcda_ (1rcd A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (9 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (9 proteins)

6. Protein (Apo)ferritin [47246] (7 species)

7. Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (7 PDB entries)

8. Domain d1rcda_: 1rcd A: [16687]
   complexed with bet

Details for d1rcda_

PDB Entry: 1rcd, 2 Å

PDB Description: bullfrog red cell l ferritin tartrate/mg/ph 5.5

PDB Compounds: (A:) l ferritin

SCOP Domain Sequences for d1rcda_:

Sequence; same for both SEQRES and ATOM records:

>d1rcda_ a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
sqvrqnfhqdceaglnrtvnlkfhssyvylsmasyfnrddvalsnfakffrerseeekeh
aeklieyqnqrggrvflqsvekperddwanglealqtalklqksvnqalldlhavaadks
dphmtdflespylsesvetikklgdhitslkklwsshpgmaeylfnkhtlg

Timeline for d1rcda_:

• d1rcda_ first appeared (with stable ids) in SCOP 1.55, called d1rcd__
  
• d1rcda_ appears in SCOP 1.73
  
• d1rcda_ appears in SCOPe 2.01
  
• d1rcda_ appears in the current release, SCOPe 2.08