SCOP 1.71: Domain d1rcd__: 1rcd -

Lineage for d1rcd__ (1rcd -)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.25: Ferritin-like [47239] (2 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (3 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (7 proteins)

6. Protein (Apo)ferritin [47246] (5 species)

7. Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (7 PDB entries)

8. Domain d1rcd__: 1rcd - [16687]
   complexed with bet

Details for d1rcd__

PDB Entry: 1rcd, 2 Å

PDB Description: bullfrog red cell l ferritin tartrate/mg/ph 5.5

SCOP Domain Sequences for d1rcd__:

Sequence; same for both SEQRES and ATOM records:

>d1rcd__ a.25.1.1 (-) (Apo)ferritin {Bullfrog (Rana catesbeiana)}
sqvrqnfhqdceaglnrtvnlkfhssyvylsmasyfnrddvalsnfakffrerseeekeh
aeklieyqnqrggrvflqsvekperddwanglealqtalklqksvnqalldlhavaadks
dphmtdflespylsesvetikklgdhitslkklwsshpgmaeylfnkhtlg

Timeline for d1rcd__:

• d1rcd__ first appeared (with stable ids) in SCOP 1.55
  
• d1rcd__ appears in SCOP 1.69
  
• d1rcd__ is called d1rcda_ in SCOP 1.73
  
• d1rcd__ appears in the current release, SCOPe 2.08, called d1rcda_