Lineage for d2ov2g1 (2ov2 G:1-177)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868094Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)
  8. 2868478Domain d2ov2g1: 2ov2 G:1-177 [166865]
    Other proteins in same PDB: d2ov2a2, d2ov2b2, d2ov2c2, d2ov2d2, d2ov2d3, d2ov2e2, d2ov2f2, d2ov2f3, d2ov2g2, d2ov2h2, d2ov2h3
    automated match to d2c2ha1
    complexed with cl, edo, gcp, mg

Details for d2ov2g1

PDB Entry: 2ov2 (more details), 2.1 Å

PDB Description: the crystal structure of the human rac3 in complex with the crib domain of human p21-activated kinase 4 (pak4)
PDB Compounds: (G:) ras-related c3 botulinum toxin substrate 3

SCOPe Domain Sequences for d2ov2g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ov2g1 c.37.1.8 (G:1-177) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldlr
ddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavl

SCOPe Domain Coordinates for d2ov2g1:

Click to download the PDB-style file with coordinates for d2ov2g1.
(The format of our PDB-style files is described here.)

Timeline for d2ov2g1: