Lineage for d2ov2c_ (2ov2 C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1595370Protein automated matches [190047] (24 species)
    not a true protein
  7. 1595427Species Human (Homo sapiens) [TaxId:9606] [186768] (124 PDB entries)
  8. 1595530Domain d2ov2c_: 2ov2 C: [166861]
    automated match to d2c2ha1
    complexed with cl, edo, gcp, mg

Details for d2ov2c_

PDB Entry: 2ov2 (more details), 2.1 Å

PDB Description: the crystal structure of the human rac3 in complex with the crib domain of human p21-activated kinase 4 (pak4)
PDB Compounds: (C:) ras-related c3 botulinum toxin substrate 3

SCOPe Domain Sequences for d2ov2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ov2c_ c.37.1.8 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldlr
ddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavlg

SCOPe Domain Coordinates for d2ov2c_:

Click to download the PDB-style file with coordinates for d2ov2c_.
(The format of our PDB-style files is described here.)

Timeline for d2ov2c_: