Lineage for d2onua_ (2onu A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2939257Protein automated matches [190124] (13 species)
    not a true protein
  7. 2939379Species Plasmodium falciparum [TaxId:36329] [187963] (5 PDB entries)
  8. 2939388Domain d2onua_: 2onu A: [166804]
    automated match to d1yh6b1
    complexed with pg4

Details for d2onua_

PDB Entry: 2onu (more details), 2.38 Å

PDB Description: plasmodium falciparum ubiquitin conjugating enzyme pf10_0330, putative homologue of human ube2h
PDB Compounds: (A:) Ubiquitin-conjugating enzyme, putative

SCOPe Domain Sequences for d2onua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2onua_ d.20.1.1 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
sltrkqcdftklimagydlelnngstqdfdvmfhgpngtayeggiwkvhvtlpddypfas
psigfmnkllhpnvdeasgsvcldvinqtwtplyslvnvfevflpqlltypnpsdplnsd
aasllmkdkniyeekvkeyvklyaskdlwe

SCOPe Domain Coordinates for d2onua_:

Click to download the PDB-style file with coordinates for d2onua_.
(The format of our PDB-style files is described here.)

Timeline for d2onua_: