Lineage for d1fha__ (1fha -)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 96482Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 96483Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 96484Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 96485Protein (Apo)ferritin [47246] (4 species)
  7. 96528Species Human (Homo sapiens), H chain [TaxId:9606] [47247] (2 PDB entries)
  8. 96530Domain d1fha__: 1fha - [16675]

Details for d1fha__

PDB Entry: 1fha (more details), 2.4 Å

PDB Description: solving the structure of human h ferritin by genetically engineering intermolecular crystal contacts

SCOP Domain Sequences for d1fha__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fha__ a.25.1.1 (-) (Apo)ferritin {Human (Homo sapiens), H chain}
tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhklatdk
ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

SCOP Domain Coordinates for d1fha__:

Click to download the PDB-style file with coordinates for d1fha__.
(The format of our PDB-style files is described here.)

Timeline for d1fha__: