SCOP 1.71: Domain d2fha__: 2fha -

Lineage for d2fha__ (2fha -)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.25: Ferritin-like [47239] (2 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (3 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (7 proteins)

6. Protein (Apo)ferritin [47246] (5 species)

7. Species Human (Homo sapiens), H chain [TaxId:9606] [47247] (2 PDB entries)

8. Domain d2fha__: 2fha - [16674]
   complexed with ca; mutant

Details for d2fha__

PDB Entry: 2fha, 1.9 Å

PDB Description: human h chain ferritin

SCOP Domain Sequences for d2fha__:

Sequence; same for both SEQRES and ATOM records:

>d2fha__ a.25.1.1 (-) (Apo)ferritin {Human (Homo sapiens), H chain}
tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhklatdk
ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

Timeline for d2fha__:

• d2fha__ first appeared (with stable ids) in SCOP 1.55
  
• d2fha__ appears in SCOP 1.69
  
• d2fha__ is called d2fhaa_ in SCOP 1.73
  
• d2fha__ appears in the current release, SCOPe 2.08, called d2fhaa_