Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (43 species) not a true protein |
Species Barley (Hordeum vulgare) [TaxId:4513] [187359] (1 PDB entry) |
Domain d2oifd_: 2oif D: [166706] automated match to d1d8ua_ complexed with cyn, hem, pgo |
PDB Entry: 2oif (more details), 1.8 Å
SCOPe Domain Sequences for d2oifd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oifd_ a.1.1.2 (D:) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]} vfseekealvlkswaimkkdsanlglrfflkifeiapsarqmfpflrdsdvpletnpklk thavsvfvmtceaaaqlrkagkitvrettlkrlggthlkygvadghfevtrfalletike alpadmwgpemrnawgeaydqlvaaikqemkp
Timeline for d2oifd_: