Lineage for d2oi9c_ (2oi9 C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1105645Protein automated matches [190119] (15 species)
    not a true protein
  7. 1105805Species Mouse (Mus musculus) [TaxId:10090] [186842] (22 PDB entries)
  8. 1105821Domain d2oi9c_: 2oi9 C: [166702]
    automated match to d2icwj1

Details for d2oi9c_

PDB Entry: 2oi9 (more details), 2.35 Å

PDB Description: Structure of the 2C/Ld/QL9 allogeneic complex
PDB Compounds: (C:) T cell receptor beta chain

SCOPe Domain Sequences for d2oi9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oi9c_ b.1.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eaavtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrliyysygagstekgdi
pdgykasrpsqenfsltlesatpsqtsvyfcasggggtlyfgagtrlsvls

SCOPe Domain Coordinates for d2oi9c_:

Click to download the PDB-style file with coordinates for d2oi9c_.
(The format of our PDB-style files is described here.)

Timeline for d2oi9c_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2oi9b_