SCOP 1.55: Domain d1bfrp_: 1bfr P:

Lineage for d1bfrp_ (1bfr P:)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.25: Ferritin-like [47239] (1 superfamily)

4. Superfamily a.25.1: Ferritin-like [47240] (2 families)

5. Family a.25.1.1: Ferritin [47241] (4 proteins)

6. Protein Bacterioferritin (cytochrome b1) [47244] (1 species)

7. Species Escherichia coli [TaxId:562] [47245] (2 PDB entries)

8. Domain d1bfrp_: 1bfr P: [16665]

Details for d1bfrp_

PDB Entry: 1bfr, 2.94 Å

PDB Description: iron storage and electron transport

SCOP Domain Sequences for d1bfrp_:

Sequence; same for both SEQRES and ATOM records:

>d1bfrp_ a.25.1.1 (P:) Bacterioferritin (cytochrome b1) {Escherichia coli}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqireeg

Timeline for d1bfrp_:

• d1bfrp_ appears in SCOP 1.57
  
• d1bfrp_ appears in the current release, SCOPe 2.08