SCOPe 2.04: Domain d2o9ta_: 2o9t A:

Lineage for d2o9ta_ (2o9t A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (60 species)
   not a true protein

7. Species Paenibacillus polymyxa [TaxId:1406] [187337] (5 PDB entries)

8. Domain d2o9ta_: 2o9t A: [166597]
   automated match to d1uyqa1
   complexed with bgc

Details for d2o9ta_

PDB Entry: 2o9t, 2.15 Å

PDB Description: beta-glucosidase b from bacillus polymyxa complexed with glucose

PDB Compounds: (A:) Beta-glucosidase B

SCOPe Domain Sequences for d2o9ta_:

Sequence; same for both SEQRES and ATOM records:

>d2o9ta_ c.1.8.0 (A:) automated matches {Paenibacillus polymyxa [TaxId: 1406]}
ntfifpatfmwgtstssyqieggtdeggrtpsiwdtfcqipgkviggdcgdvacdhfhhf
kedvqlmkqlgflhyrfsvawprimpaagiineegllfyehlldeielaglipmltlyhw
dlpqwiedeggwtqretiqhfktyasvimdrfgerinwwntinepycasilgygtgehap
ghenwreaftaahhilmchgiasnlhkekgltgkigitlnmehvdaaserpedvaaairr
dgfinrwfaeplfngkypedmvewygtylngldfvqpgdmeliqqpgdflginyytrsii
rstndasllqveqvhmeepvtdmgweihpesfyklltriekdfskglpilitengaamrd
elvngqiedtgrqryieehlkachrfieeggqlkgyfvwsfldnfewawgyskrfgivhi
nyetqertpkqsalwfkqmmakngf

Timeline for d2o9ta_:

• d2o9ta_ first appeared in SCOPe 2.01
  
• d2o9ta_ appears in SCOPe 2.03
  
• d2o9ta_ appears in SCOPe 2.05
  
• d2o9ta_ appears in the current release, SCOPe 2.08