Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
Protein automated matches [190457] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries) |
Domain d2o9sa1: 2o9s A:824-884 [166596] Other proteins in same PDB: d2o9sa2 automated match to d1oota_ complexed with cl, na, scn |
PDB Entry: 2o9s (more details), 0.83 Å
SCOPe Domain Sequences for d2o9sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o9sa1 b.34.2.0 (A:824-884) automated matches {Human (Homo sapiens) [TaxId: 9606]} geaiakfnfngdtqvemsfrkgeritllrqvdenwyegripgtsrqgifpityvdvikrp l
Timeline for d2o9sa1: