Lineage for d2o89a_ (2o89 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876194Protein Thioredoxin [52835] (16 species)
  7. 2876419Species Staphylococcus aureus [TaxId:1280] [187358] (5 PDB entries)
  8. 2876425Domain d2o89a_: 2o89 A: [166583]
    automated match to d1nswa_
    mutant

Details for d2o89a_

PDB Entry: 2o89 (more details), 2.55 Å

PDB Description: s. aureus thioredoxin p31t/c32s mutant
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d2o89a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o89a_ c.47.1.1 (A:) Thioredoxin {Staphylococcus aureus [TaxId: 1280]}
aivkvtdadfdskvesgvqlvdfwatwcgtskmiapvleelaadyegkadilkldvdenp
staakyevmsiptlivfkdgqpvdkvvgfqpkenlaevldkhl

SCOPe Domain Coordinates for d2o89a_:

Click to download the PDB-style file with coordinates for d2o89a_.
(The format of our PDB-style files is described here.)

Timeline for d2o89a_: