SCOPe 2.06: Domain d2o7ka_: 2o7k A:

Lineage for d2o7ka_ (2o7k A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Staphylococcus aureus [TaxId:1280] [187358] (5 PDB entries)

8. Domain d2o7ka_: 2o7k A: [166570]
   automated match to d1nswa_

Details for d2o7ka_

PDB Entry: 2o7k, 2.2 Å

PDB Description: s. aureus thioredoxin

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d2o7ka_:

Sequence; same for both SEQRES and ATOM records:

>d2o7ka_ c.47.1.1 (A:) Thioredoxin {Staphylococcus aureus [TaxId: 1280]}
aivkvtdadfdskvesgvqlvdfwatwcgpckmiapvleelaadyegkadilkldvdenp
staakyevmsiptlivfkdgqpvdkvvgfqpkenlaevldkhl

Timeline for d2o7ka_:

• d2o7ka_ first appeared in SCOPe 2.01
  
• d2o7ka_ appears in SCOPe 2.05
  
• d2o7ka_ appears in SCOPe 2.07
  
• d2o7ka_ appears in the current release, SCOPe 2.08