Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
Protein automated matches [190230] (20 species) not a true protein |
Species Fasciola hepatica [TaxId:6192] [188299] (1 PDB entry) |
Domain d2o6xa_: 2o6x A: [166568] automated match to d1by8a_ |
PDB Entry: 2o6x (more details), 1.4 Å
SCOPe Domain Sequences for d2o6xa_:
Sequence, based on SEQRES records: (download)
>d2o6xa_ d.3.1.0 (A:) automated matches {Fasciola hepatica [TaxId: 6192]} nddlwhqwkrmynkeyngaddqhrrniweknvkhiqehnlrhdlglvtytlglnqftdmt feefkakyltemsrasdilshgvpyeannravpdkidwresgyvtevkdqgncgsgwafs ttgtmegqymknertsisfseqqlvdcsrpwgnngcggglmenayqylkqfgletessyp ytavegqcrynkqlgvakvtgfytvhsgsevelknlvgaegpaavavdvesdfmmyrsgi yqsqtcsplrvnhavlavgygtqggtdywivknswglswgergyirmvrnrgnmcgiasl aslpmvarfp
>d2o6xa_ d.3.1.0 (A:) automated matches {Fasciola hepatica [TaxId: 6192]} nddlwhqwkrmynkeyngaddqhrrniweknvkhiqehnlrhdlglvtytlglnqftdmt feefkakyltemsrasdilshgvpyeavpdkidwresgyvtevkdqgncgsgwafsttgt megqymknertsisfseqqlvdcsrpwgnngcggglmenayqylkqfgletessypytav egqcrynkqlgvakvtgfytvhsgsevelknlvgaegpaavavdvesdfmmyrsgiyqsq tcsplrvnhavlavgygtqggtdywivknswglswgergyirmvrnrgnmcgiaslaslp mvarfp
Timeline for d2o6xa_: