Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.5: Neurolysin-like [55505] (5 proteins) combines M2, M3 and M32 families of metalloproteases the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain |
Protein automated matches [190340] (5 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [187944] (2 PDB entries) |
Domain d2o3ea_: 2o3e A: [166519] automated match to d1i1ip_ complexed with zn |
PDB Entry: 2o3e (more details), 2.2 Å
SCOPe Domain Sequences for d2o3ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o3ea_ d.92.1.5 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} mssytaagrnvlrwdlspeqiktrteqliaqtkqvydtvgtialkevtyenclqvladie vtyivertmldfpqhvssdrevraasteadkklsrfdiemsmredvfqrivhlqetcdle kikpearryleksikmgkrnglhlsehirneiksmkkrmselcidfnknlneddtslvfs kaelgalpddfidslektdedkykvtlkyphyfpvmkkccvpetrrkmemafhtrckqen tailqqllplraqvakllgynthadfvlelntakstsrvaaflddlsqklkplgeaeref ilslkkkeceergfeydgkinawdlhyymtqteelkysvdqeslkeyfpievvtegllsi yqellglsfeqvpdahvwnksvslytvkdkatgevlgqfyldlypregkynhaacfglqp gcllpdgsrmmsvaalvvnfsqpvagrpsllrhdevetyfhefghvmhqicaqtdfarfs gtnverdfvevpsqmlenwvwdvdslrklskhykdghpitdelleklvasrlvntglltl rqivlskvdqslhtnatldaaseyakycteilgvaatpgtnmpatfghlaggydgqyygy lwsevfsmdmfhscfkkegimnpevgmkyrnlilkpggsldgmdmlqnflqrepnqkafl msrgl
Timeline for d2o3ea_: