SCOP 1.69: Domain d1b71a1: 1b71 A:1-147

Lineage for d1b71a1 (1b71 A:1-147)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.25: Ferritin-like [47239] (2 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (3 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (7 proteins)

6. Protein Rubrerythrin, N-terminal domain [47242] (2 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [47243] (10 PDB entries)

8. Domain d1b71a1: 1b71 A:1-147 [16647]
   Other proteins in same PDB: d1b71a2

Details for d1b71a1

PDB Entry: 1b71, 1.9 Å

PDB Description: rubrerythrin

SCOP Domain Sequences for d1b71a1:

Sequence; same for both SEQRES and ATOM records:

>d1b71a1 a.25.1.1 (A:1-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris}
mkslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrl
fkfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarv
fasiavaeefhekrfldfarnikegrv

Timeline for d1b71a1:

• d1b71a1 first appeared (with stable ids) in SCOP 1.55
  
• d1b71a1 appears in SCOP 1.67
  
• d1b71a1 appears in SCOP 1.71
  
• d1b71a1 appears in the current release, SCOPe 2.08