Lineage for d1b71a1 (1b71 A:1-147)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.25: Ferritin-like [47239] (1 superfamily) Superfamily a.25.1: Ferritin-like [47240] (2 families) 
Family a.25.1.1: Ferritin [47241] (4 proteins) 
Protein Rubrerythrin, N-terminal domain [47242] (1 species) Species Desulfovibrio vulgaris [TaxId:881] [47243] (3 PDB entries) 
Domain d1b71a1: 1b71 A:1-147 [16647]
Other proteins in same PDB: d1b71a2
Details for d1b71a1
PDB Entry: 1b71 (more details), 1.9 Å
PDB Description: rubrerythrin
SCOP Domain Sequences for d1b71a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b71a1 a.25.1.1 (A:1-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris}
mkslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrl
fkfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarv
fasiavaeefhekrfldfarnikegrv
SCOP Domain Coordinates for d1b71a1:
Click to download the PDB-style file with coordinates for d1b71a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b71a1:
- d1b71a1 appears in SCOP 1.57
- d1b71a1 appears in the current release, SCOPe 2.08
View in 3D
