Lineage for d2nzaa_ (2nza A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 921121Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 921122Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 921123Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 921485Protein automated matches [190068] (8 species)
    not a true protein
  7. 921522Species Streptomyces coelicolor [TaxId:100226] [187338] (7 PDB entries)
  8. 921531Domain d2nzaa_: 2nza A: [166464]
    automated match to d1s1fa_
    complexed with hem

Details for d2nzaa_

PDB Entry: 2nza (more details), 2.9 Å

PDB Description: Structure and Function Studies of Cytochrome P450 158A1 from Streptomyces coelicolor A3(2)
PDB Compounds: (A:) Cytochrome P450 CYP158A1

SCOPe Domain Sequences for d2nzaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nzaa_ a.104.1.1 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
pppvrdwpaldldgpefdpvlaelmregpltrvrlphgegwawlatryddvkaitndprf
graevtqrqitrlaphfkprpgslafadqpdhnrlrravagaftvgatkrlrpraqeild
glvdgilaegppadlvervlepfpiavvsevmgvpaadrervhswtrqiistsggaeaae
rakrglygwitetvraragseggdvysmlgaavgrgevgeteavglagplqiggeavthn
vgqmlyllltrrelmarmrerpgargtaldellrwishrtsvglarialedvevhgtria
agepvyvsylaanrdpdvfpdpdridldrdpnphlaygnghhfctgavlarmqtellvdt
llerlpglrlavpaeqvawrrktmirgprtlpctwhh

SCOPe Domain Coordinates for d2nzaa_:

Click to download the PDB-style file with coordinates for d2nzaa_.
(The format of our PDB-style files is described here.)

Timeline for d2nzaa_: