Lineage for d1ryta1 (1ryt A:2-147)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1989404Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1990354Protein Rubrerythrin, N-terminal domain [47242] (2 species)
  7. 1990355Species Desulfovibrio vulgaris [TaxId:881] [47243] (10 PDB entries)
    Uniprot P24931
  8. 1990363Domain d1ryta1: 1ryt A:2-147 [16646]
    Other proteins in same PDB: d1ryta2
    complexed with fe

Details for d1ryta1

PDB Entry: 1ryt (more details), 2.1 Å

PDB Description: rubrerythrin
PDB Compounds: (A:) rubrerythrin

SCOPe Domain Sequences for d1ryta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ryta1 a.25.1.1 (A:2-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf
kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf
asiavaeefhekrfldfarnikegrv

SCOPe Domain Coordinates for d1ryta1:

Click to download the PDB-style file with coordinates for d1ryta1.
(The format of our PDB-style files is described here.)

Timeline for d1ryta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ryta2