SCOPe 2.02: Domain d1ryta1: 1ryt A:2-147

Lineage for d1ryta1 (1ryt A:2-147)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Rubrerythrin, N-terminal domain [47242] (2 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [47243] (10 PDB entries)
   Uniprot P24931

8. Domain d1ryta1: 1ryt A:2-147 [16646]
   Other proteins in same PDB: d1ryta2
   complexed with fe

Details for d1ryta1

PDB Entry: 1ryt, 2.1 Å

PDB Description: rubrerythrin

PDB Compounds: (A:) rubrerythrin

SCOPe Domain Sequences for d1ryta1:

Sequence; same for both SEQRES and ATOM records:

>d1ryta1 a.25.1.1 (A:2-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf
kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf
asiavaeefhekrfldfarnikegrv

Timeline for d1ryta1:

• d1ryta1 first appeared (with stable ids) in SCOP 1.55, called d1ryt_1
  
• d1ryta1 appears in SCOPe 2.01
  
• d1ryta1 appears in SCOPe 2.03
  
• d1ryta1 appears in the current release, SCOPe 2.08