SCOP 1.63: Domain d1ryt_1: 1ryt 2-147

Lineage for d1ryt_1 (1ryt 2-147)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.25: Ferritin-like [47239] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (2 families)
   contains dimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (5 proteins)

6. Protein Rubrerythrin, N-terminal domain [47242] (1 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [47243] (7 PDB entries)

8. Domain d1ryt_1: 1ryt 2-147 [16646]
   Other proteins in same PDB: d1ryt_2
   complexed with fe

Details for d1ryt_1

PDB Entry: 1ryt, 2.1 Å

PDB Description: rubrerythrin

SCOP Domain Sequences for d1ryt_1:

Sequence; same for both SEQRES and ATOM records:

>d1ryt_1 a.25.1.1 (2-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris}
kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf
kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf
asiavaeefhekrfldfarnikegrv

Timeline for d1ryt_1:

• d1ryt_1 first appeared (with stable ids) in SCOP 1.55
  
• d1ryt_1 appears in SCOP 1.61
  
• d1ryt_1 appears in SCOP 1.65
  
• d1ryt_1 appears in the current release, SCOPe 2.08, called d1ryta1