Lineage for d1ryt_1 (1ryt 2-147)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.25: Ferritin-like [47239] (1 superfamily) Superfamily a.25.1: Ferritin-like [47240] (2 families) 
Family a.25.1.1: Ferritin [47241] (4 proteins) 
Protein Rubrerythrin, N-terminal domain [47242] (1 species) Species Desulfovibrio vulgaris [TaxId:881] [47243] (3 PDB entries) 
Domain d1ryt_1: 1ryt 2-147 [16646]
Other proteins in same PDB: d1ryt_2
Details for d1ryt_1
PDB Entry: 1ryt (more details), 2.1 Å
PDB Description: rubrerythrin
SCOP Domain Sequences for d1ryt_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ryt_1 a.25.1.1 (2-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris}
kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf
kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf
asiavaeefhekrfldfarnikegrv
SCOP Domain Coordinates for d1ryt_1:
Click to download the PDB-style file with coordinates for d1ryt_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ryt_1:
- d1ryt_1 appears in SCOP 1.57
- d1ryt_1 appears in the current release, SCOPe 2.08, called d1ryta1
View in 3D
