Lineage for d2nxxh_ (2nxx H:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011944Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2011945Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2011946Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2012913Protein automated matches [190059] (14 species)
    not a true protein
  7. 2013265Species Tribolium castaneum [TaxId:7070] [188215] (1 PDB entry)
  8. 2013273Domain d2nxxh_: 2nxx H: [166455]
    automated match to d1r20d_
    complexed with p1a

Details for d2nxxh_

PDB Entry: 2nxx (more details), 2.75 Å

PDB Description: crystal structure of the ligand-binding domains of the t.castaneum (coleoptera) heterodimer ecrusp bound to ponasterone a
PDB Compounds: (H:) Ecdysone Receptor (EcR, NRH1)

SCOPe Domain Sequences for d2nxxh_:

Sequence, based on SEQRES records: (download)

>d2nxxh_ a.123.1.1 (H:) automated matches {Tribolium castaneum [TaxId: 7070]}
ispeqeelihrlvyfqneyehpseedvkriinqpmdgedqcdvrfrhiteitiltvqliv
efakrlpgfdkllredqiallkacssevmmfrmarrydvqtdsilfvnnqpysrdsynla
gmgetiedllhfcrtmysmrvdnaeyalltaivifserpaliegwkvekiqeiylealra
yvdnrrkpkpgtifakllsvltelrtlgnqnsemcfslklknkklppflaeiwdvdl

Sequence, based on observed residues (ATOM records): (download)

>d2nxxh_ a.123.1.1 (H:) automated matches {Tribolium castaneum [TaxId: 7070]}
ispeqeelihrlvyfqneyehpseedvkriindgedqcdvrfrhiteitiltvqlivefa
krlpgfdkllredqiallkacssevmmfrmarrydvqtdsilfvnnqpysrdsynlagmg
etiedllhfcrtmysmrvdnaeyalltaivifserpaliegwkvekiqeiylealrayvd
nrrkpkpgtifakllsvltelrtlgnqnsemcfslklknkklppflaeiwdvdl

SCOPe Domain Coordinates for d2nxxh_:

Click to download the PDB-style file with coordinates for d2nxxh_.
(The format of our PDB-style files is described here.)

Timeline for d2nxxh_: