Lineage for d2nxxg_ (2nxx G:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1747085Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1747086Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1747087Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1747981Protein automated matches [190059] (14 species)
    not a true protein
  7. 1748262Species Tribolium castaneum [TaxId:7070] [188215] (1 PDB entry)
  8. 1748269Domain d2nxxg_: 2nxx G: [166454]
    automated match to d1r20d_
    complexed with p1a

Details for d2nxxg_

PDB Entry: 2nxx (more details), 2.75 Å

PDB Description: crystal structure of the ligand-binding domains of the t.castaneum (coleoptera) heterodimer ecrusp bound to ponasterone a
PDB Compounds: (G:) Ecdysone Receptor (EcR, NRH1)

SCOPe Domain Sequences for d2nxxg_:

Sequence, based on SEQRES records: (download)

>d2nxxg_ a.123.1.1 (G:) automated matches {Tribolium castaneum [TaxId: 7070]}
ispeqeelihrlvyfqneyehpseedvkriinqpmdgedqcdvrfrhiteitiltvqliv
efakrlpgfdkllredqiallkacssevmmfrmarrydvqtdsilfvnnqpysrdsynla
gmgetiedllhfcrtmysmrvdnaeyalltaivifserpaliegwkvekiqeiylealra
yvdnrrkpkpgtifakllsvltelrtlgnqnsemcfslklknkklppflaeiwdvd

Sequence, based on observed residues (ATOM records): (download)

>d2nxxg_ a.123.1.1 (G:) automated matches {Tribolium castaneum [TaxId: 7070]}
ispeqeelihrlvyfqneyehpseedvkriindgedqcdvrfrhiteitiltvqlivefa
krlpgfdkllredqiallkacssevmmfrmarrydvqtdsilfvnnqpysrdsynlagmg
etiedllhfcrtmysmrvdnaeyalltaivifserpaliegwkvekiqeiylealrayvd
nrrkpkpgtifakllsvltelrtlgnqnsemcfslklknkklppflaeiwdvd

SCOPe Domain Coordinates for d2nxxg_:

Click to download the PDB-style file with coordinates for d2nxxg_.
(The format of our PDB-style files is described here.)

Timeline for d2nxxg_: