Class a: All alpha proteins [46456] (284 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
Protein automated matches [190059] (10 species) not a true protein |
Species Tribolium castaneum [TaxId:7070] [188215] (1 PDB entry) |
Domain d2nxxe_: 2nxx E: [166452] automated match to d1r20d_ complexed with p1a |
PDB Entry: 2nxx (more details), 2.75 Å
SCOPe Domain Sequences for d2nxxe_:
Sequence, based on SEQRES records: (download)
>d2nxxe_ a.123.1.1 (E:) automated matches {Tribolium castaneum [TaxId: 7070]} ispeqeelihrlvyfqneyehpseedvkriinqpmdgedqcdvrfrhiteitiltvqliv efakrlpgfdkllredqiallkacssevmmfrmarrydvqtdsilfvnnqpysrdsynla gmgetiedllhfcrtmysmrvdnaeyalltaivifserpaliegwkvekiqeiylealra yvdnrrkpkpgtifakllsvltelrtlgnqnsemcfslklknkklppflaeiwdvdl
>d2nxxe_ a.123.1.1 (E:) automated matches {Tribolium castaneum [TaxId: 7070]} ispeqeelihrlvyfqneyehpseedvkriindgedqcdvrfrhiteitiltvqlivefa krlpgfdkllredqiallkacssevmmfrmarrydvqtdsilfvnnqpysrdsynlagmg etiedllhfcrtmysmrvdnaeyalltaivifserpaliegwkvekiqeiylealrayvd nrrkpkpgtifakllsvltelrtlgnqnsemcfslklknkklppflaeiwdvdl
Timeline for d2nxxe_: