Lineage for d1g4us1 (1g4u S:167-296)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 535478Fold a.24: Four-helical up-and-down bundle [47161] (24 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 535723Superfamily a.24.11: Bacterial GAP domain [47233] (1 family) (S)
    contains extra helices in the loops at one end of the bundle
  5. 535724Family a.24.11.1: Bacterial GAP domain [47234] (3 proteins)
  6. 535730Protein SptP tyrosine phosphatase [47237] (1 species)
  7. 535731Species Salmonella typhimurium [TaxId:90371] [47238] (2 PDB entries)
  8. 535732Domain d1g4us1: 1g4u S:167-296 [16643]
    Other proteins in same PDB: d1g4ur_, d1g4us2
    complexed with af3, gdp, mg; mutant

Details for d1g4us1

PDB Entry: 1g4u (more details), 2.3 Å

PDB Description: crystal structure of the salmonella tyrosine phosphatase and gtpase activating protein sptp bound to rac1

SCOP Domain Sequences for d1g4us1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g4us1 a.24.11.1 (S:167-296) SptP tyrosine phosphatase {Salmonella typhimurium}
skqplldialkglkrtlpqleqmdgnslrenfqemasgngplrslmtnlqnlnkipeakq
lndyvttltniqvgvarfsqwgtcggeverwvdkastheltqavkkihviakelknvtae
lekieagapm

SCOP Domain Coordinates for d1g4us1:

Click to download the PDB-style file with coordinates for d1g4us1.
(The format of our PDB-style files is described here.)

Timeline for d1g4us1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g4us2
View in 3D
Domains from other chains:
(mouse over for more information)
d1g4ur_