SCOPe 2.05: Domain d2nwoa_: 2nwo A:

Lineage for d2nwoa_ (2nwo A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (555 PDB entries)
   Uniprot P00918

8. Domain d2nwoa_: 2nwo A: [166384]
   automated match to d1cana_
   complexed with zn; mutant

Details for d2nwoa_

PDB Entry: 2nwo, 1.7 Å

PDB Description: structural and kinetic effect of hydrophobic mutations in the active site of human carbonic anhydrase ii

PDB Compounds: (A:) Carbonic anhydrase 2

SCOPe Domain Sequences for d2nwoa_:

Sequence; same for both SEQRES and ATOM records:

>d2nwoa_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnl
ghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

Timeline for d2nwoa_:

• d2nwoa_ first appeared in SCOPe 2.01
  
• d2nwoa_ appears in SCOPe 2.04
  
• d2nwoa_ appears in SCOPe 2.06
  
• d2nwoa_ appears in the current release, SCOPe 2.08