SCOPe 2.08: Domain d2nuxb_: 2nux B:

Lineage for d2nuxb_ (2nux B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (94 species)
   not a true protein

7. Species Sulfolobus acidocaldarius [TaxId:330779] [187925] (3 PDB entries)

8. Domain d2nuxb_: 2nux B: [166365]
   automated match to d1w37a_
   complexed with mg

Details for d2nuxb_

PDB Entry: 2nux, 2.5 Å

PDB Description: 2-keto-3-deoxygluconate aldolase from sulfolobus acidocaldarius, native structure in p6522 at 2.5 a resolution

PDB Compounds: (B:) 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho gluconate aldolase

SCOPe Domain Sequences for d2nuxb_:

Sequence; same for both SEQRES and ATOM records:

>d2nuxb_ c.1.10.0 (B:) automated matches {Sulfolobus acidocaldarius [TaxId: 330779]}
meiispiitpfdkqgkvnvdalkthaknllekgidaifvngttglgpalskdekrqnlna
lydvthklifqvgslnlndvmelvkfsnemdilgvsshspyyfprlpekflakyyeeiar
isshslyiynypaatgydippsilkslpvkgikdtnqdlahsleyklnlpgvkvyngsnt
liyysllsldgvvasftnfipevivkqrdlikqgklddalrlqelinrladilrkygsis
aiyvlvnefqgydvgyprppifpltdeealslkreieplkrkiqelvh

Timeline for d2nuxb_:

• d2nuxb_ first appeared in SCOPe 2.01
  
• d2nuxb_ appears in SCOPe 2.07