Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (94 species) not a true protein |
Species Sulfolobus acidocaldarius [TaxId:330779] [187925] (3 PDB entries) |
Domain d2nuxb_: 2nux B: [166365] automated match to d1w37a_ complexed with mg |
PDB Entry: 2nux (more details), 2.5 Å
SCOPe Domain Sequences for d2nuxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nuxb_ c.1.10.0 (B:) automated matches {Sulfolobus acidocaldarius [TaxId: 330779]} meiispiitpfdkqgkvnvdalkthaknllekgidaifvngttglgpalskdekrqnlna lydvthklifqvgslnlndvmelvkfsnemdilgvsshspyyfprlpekflakyyeeiar isshslyiynypaatgydippsilkslpvkgikdtnqdlahsleyklnlpgvkvyngsnt liyysllsldgvvasftnfipevivkqrdlikqgklddalrlqelinrladilrkygsis aiyvlvnefqgydvgyprppifpltdeealslkreieplkrkiqelvh
Timeline for d2nuxb_: