SCOPe 2.02: Domain d2jeda_: 2jed A:

Lineage for d2jeda_ (2jed A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (293 PDB entries)

8. Domain d2jeda_: 2jed A: [166147]
   automated match to d1xjda_
   complexed with lg8, mpd

Details for d2jeda_

PDB Entry: 2jed, 2.32 Å

PDB Description: the crystal structure of the kinase domain of the protein kinase c theta in complex with nvp-xaa228 at 2.32a resolution.

PDB Compounds: (A:) protein kinase c theta

SCOPe Domain Sequences for d2jeda_:

Sequence; same for both SEQRES and ATOM records:

>d2jeda_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkiedfelhkmlgkgsfgkvflaefkktnqffaikalkkdvvlmdddvectmvekrvlsl
awehpflthmfctfqtkenlffvmeylnggdlmyhiqschkfdlsratfyaaeiilglqf
lhskgivyrdlkldnilldkdghikiadfgmckenmlgdaktnefcgtpdyiapeillgq
kynhsvdwwsfgvllyemligqspfhgqdeeelfhsirmdnpfyprwlekeakdllvklf
vrepekrlgvrgdirqhplfreinweelerkeidppfrpkvkspfdcsnfdkeflnekpr
lsfadralinsmdqnmfrnfsfmnpg

Timeline for d2jeda_:

• d2jeda_ first appeared in SCOPe 2.01
  
• d2jeda_ appears in SCOPe 2.03
  
• d2jeda_ appears in the current release, SCOPe 2.08