Lineage for d2fapb_ (2fap B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.24: Four-helical up-and-down bundle [47161] (11 superfamilies) 
Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family) 
Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (1 protein) Protein FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47214] (1 species) Species Human (Homo sapiens) [TaxId:9606] [47215] (6 PDB entries) 
Domain d2fapb_: 2fap B: [16614]
Other proteins in same PDB: d2fapa_
Details for d2fapb_
PDB Entry: 2fap (more details), 2.2 Å
PDB Description: the structure of the immunophilin-immunosuppressant fkbp12-(c16)-ethoxy rapamycin complex interacting with huma
SCOP Domain Sequences for d2fapb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fapb_ a.24.7.1 (B:) FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) {Human (Homo sapiens)}
vailwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdl
meaqewcrkymksgnvkdltqawdlyyhvfrris
SCOP Domain Coordinates for d2fapb_:
Click to download the PDB-style file with coordinates for d2fapb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fapb_:
- d2fapb_ appears in SCOP 1.57
- d2fapb_ appears in the current release, SCOPe 2.08
View in 3D
