SCOP 1.73: Domain d3fapb_: 3fap B:

Lineage for d3fapb_ (3fap B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family)

5. Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (1 protein)

6. Protein FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47214] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47215] (7 PDB entries)

8. Domain d3fapb_: 3fap B: [16612]
   Other proteins in same PDB: d3fapa_
   complexed with ard

Details for d3fapb_

PDB Entry: 3fap, 1.85 Å

PDB Description: atomic structures of the rapamycin analogs in complex with both human fkbp12 and frb domain of frap

PDB Compounds: (B:) fkbp12-rapamycin associated protein

SCOP Domain Sequences for d3fapb_:

Sequence; same for both SEQRES and ATOM records:

>d3fapb_ a.24.7.1 (B:) FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) {Human (Homo sapiens) [TaxId: 9606]}
vailwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdl
meaqewcrkymksgnvkdltqawdlyyhvfrris

Timeline for d3fapb_:

• d3fapb_ first appeared (with stable ids) in SCOP 1.55
  
• d3fapb_ appears in SCOP 1.71
  
• d3fapb_ appears in SCOP 1.75
  
• d3fapb_ appears in the current release, SCOPe 2.08