Lineage for d1ivhc1 (1ivh C:242-392)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 354724Fold a.29: Bromodomain-like [47363] (5 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 354743Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 354744Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (5 proteins)
  6. 354758Protein Isovaleryl-CoA dehydrogenase, C-domain [47210] (1 species)
  7. 354759Species Human (Homo sapiens) [TaxId:9606] [47211] (1 PDB entry)
  8. 354762Domain d1ivhc1: 1ivh C:242-392 [16610]
    Other proteins in same PDB: d1ivha2, d1ivhb2, d1ivhc2, d1ivhd2

Details for d1ivhc1

PDB Entry: 1ivh (more details), 2.6 Å

PDB Description: structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity

SCOP Domain Sequences for d1ivhc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivhc1 a.29.3.1 (C:242-392) Isovaleryl-CoA dehydrogenase, C-domain {Human (Homo sapiens)}
kgvyvlmsgldlerlvlaggplglmqavldhtipylhvreafgqkighfqlmqgkmadmy
trlmacrqyvynvakacdeghctakdcagvilysaecatqvaldgiqcfggngyindfpm
grflrdaklyeigagtsevrrlvigrafnad

SCOP Domain Coordinates for d1ivhc1:

Click to download the PDB-style file with coordinates for d1ivhc1.
(The format of our PDB-style files is described here.)

Timeline for d1ivhc1: