Lineage for d1ivhb1 (1ivh B:242-392)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487717Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1488075Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1488076Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)
  6. 1488111Protein Isovaleryl-CoA dehydrogenase, C-domain [47210] (1 species)
  7. 1488112Species Human (Homo sapiens) [TaxId:9606] [47211] (1 PDB entry)
  8. 1488114Domain d1ivhb1: 1ivh B:242-392 [16609]
    Other proteins in same PDB: d1ivha2, d1ivhb2, d1ivhc2, d1ivhd2
    complexed with cos, fad

Details for d1ivhb1

PDB Entry: 1ivh (more details), 2.6 Å

PDB Description: structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity
PDB Compounds: (B:) isovaleryl-coa dehydrogenase

SCOPe Domain Sequences for d1ivhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivhb1 a.29.3.1 (B:242-392) Isovaleryl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]}
kgvyvlmsgldlerlvlaggplglmqavldhtipylhvreafgqkighfqlmqgkmadmy
trlmacrqyvynvakacdeghctakdcagvilysaecatqvaldgiqcfggngyindfpm
grflrdaklyeigagtsevrrlvigrafnad

SCOPe Domain Coordinates for d1ivhb1:

Click to download the PDB-style file with coordinates for d1ivhb1.
(The format of our PDB-style files is described here.)

Timeline for d1ivhb1: